![]() |
![]() |
Your cart is empty |
||
Books > Professional & Technical > Energy technology & engineering > Nuclear power & engineering
In dem vorliegenden Band wird naturwissenschaftlich-physikalische Hintergrundinformation zum Thema Energie bereitgestellt, um dem Leser objektive Bewertungskriterien fur die global hochaktuelle Diskussion der Zukunft unserer Energieversorgung an die Hand zu geben. Insbesondere ist es ein zentrales Anliegen, dem Leser eine Bilanzierung aller Quellen hinsichtlich der Einflussnahme ihrer Gewinnung und Verwendung auf die Umwelt zu erstellen und das jeweilige Risiko zueinander in Relation zu setzen. Nach Festlegung des Begriffes Energie und ihrer Erscheinungsformen werden globale Randbedingungen des Umgangs mit Energie aufgezeigt. Diese Randbedingungen werden sodann fur Deutschland als typischem Industrieland enger eingegrenzt. Die Palette infrage kommender Quellen, fossile, erneuerbare und nukleare, wird sodann im Detail vorgestellt. Ergiebigkeit der Ressourcen sowie sonstige Moglichkeiten und Grenzen des Einsatzes werden diskutiert; alle Energiequellen werden sodann nach Definition eines energetischen Erntefaktors miteinander verglichen. Die Speicher- und Transportmoglichkeiten und - hiermit eng verbunden - die Handlungsspielraume rationellen Umgangs mit den diversen Formen der Energie bilden einen weiteren Schwerpunkt. Der an naturwissenschaftlicher Hintergrundinformation interessierte Leser findet in einem gesonderten Kapitel eine detaillierte Prasentierung ausgewahlter Techniken."
Im Buch Reaktortechnik werden die physikalisch-technischen Grundlagen und deren konkrete Umsetzung in Kraftwerken beschrieben. Nach der Darstellung der kernphysikalischen und thermohydraulischen Grundlagen beschreiben die Autoren Grundprinzipien und Aufbau bewahrter Reaktorkonzepte ebenso wie die neuen Entwicklungen. Einen weiteren Schwerpunkt bilden Betrieb, Werkstoff- und Zuverlassigkeitsfragen. Abschliessend gehen die Autoren auf den Brennstoffkreislauf vom Uranabbau bis zur Entsorgung ein. Motivation der Herausgeber war, den heutigen Stand des Wissens der Reaktortechnik zusammenzutragen und Ingenieuren in Studium und Praxis zuganglich zu machen. Das Buch basiert auf dem von Albert Ziegler herausgegebenen Standardwerk der Reaktortechnik. Das Buch eignet sich nicht nur als Lehrbuch fur Studierende, sondern auch als Nachschlagewerk fur die berufliche Praxis.
Seit Hiroshima gilt die Atombombe als singulare Waffe. Ihre Auswirkungen in Raum und Zeit sind analogielos. Ein machtiges Tabu liegt auf ihrer Anwendung. Ihr Besitz war nur funf Staaten erlaubt. Gleichzeitig wurde sie von Anfang an politisch und strategisch instrumentalisiert. Das "Gleichgewicht des Schreckens" wurde zum Signum des Atomzeitalters. Nach 1989 scheint sich dieses Tabu allmahlich aufzuloesen. Die Zahl der Staaten, die uber Nuklearwaffen verfugen, wachst langsam, aber sie wachst. Eine Gruppe von zwoelf Wissenschaftlern - Physikern, Kerntechnikern, Politologen, Historikern und einem Voelkerrechtler - hat die verschiedenen Aspekte der Singularitatsthese diskutiert und legt jetzt die Ergebnisse ihrer Arbeit in zwoelf Aufsatzen vor. Jeder Autor betont andere Aspekte. Der Band enthalt also weder abschliessende noch gar einfache Loesungen. Er zeigt, dass die von Vielen geforderte Abschaffung der Kernwaffen und damit das Ende des Atomzeitalters erst moeglich wird, wenn man die politischen, militarischen, technischen und sozialen Hindernisse klar erkennt, die es zu uberwinden gilt. Seit Hiroshima gilt die Atombombe als singulare Waffe. Ihre Auswirkungen in Raum und Zeit sind analogielos. Ein machtiges Tabu liegt auf ihrer Anwendung. Ihr Besitz war nur funf Staaten erlaubt. Gleichzeitig wurde sie von Anfang an politisch und strategisch instrumentalisiert. Das "Gleichgewicht des Schreckens" wurde zum Signum des Atomzeitalters. Nach 1989 scheint sich dieses Tabu allmahlich aufzuloesen. Die Zahl der Staaten, die uber Nuklearwaffen verfugen, wachst langsam, aber sie wachst. Eine Gruppe von zwoelf Wissenschaftlern - Physikern, Kerntechnikern, Politologen, Historikern und einem Voelkerrechtler - hat die verschiedenen Aspekte der Singularitatsthese diskutiert und legt jetzt die Ergebnisse ihrer Arbeit in zwoelf Aufsatzen vor. Jeder Autor betont andere Aspekte. Der Band enthalt also weder abschliessende noch gar einfache Loesungen. Er zeigt, dass die von Vielen geforderte Abschaffung der Kernwaffen und damit das Ende des Atomzeitalters erst moeglich wird, wenn man die politischen, militarischen, technischen und sozialen Hindernisse klar erkennt, die es zu uberwinden gilt. UEber die Beitragsautoren: Dr. Leopold Barleon, Ing., Kernforschungszentrum Karlsruhe Prof. Dr. Hans-Joachim Bieber, Historiker, Universitat Kassel Dr. Eric Chauvistre, Politikwissenschaftler, FU Berlin/ Redakteur ZDF, Reuters, TAZ Dr. Constanze Eisenbart, Historikerin, Forschungsstatte der Evangelischen Studiengemeinschaft Heidelberg Prof. Dr. Christopher Daase, Politikwissenschaftler, Hessische Stiftung Friedens- und Konfliktforschung, Frankfurt Wilhelm Gmelin, Ing. Luft- und Raumfahrttechniker, ehem. Direktor der EURATOM Prof. Dr. Erwin Hackel, Politikwissenschaftler, Universitat Konstanz Prof. Dr. Martin Kalinowski, Kernphysikerer, Direktor des Carl Friedrich von Weizsacker-Zentrums der Universitat Hamburg Prof. Dr. Egbert Kankeleit, Kernphysiker em., TU Darmstadt Prof. Dr. Thilo Marauhn, Jurist, Universitat Giessen Dr. Christoph Pistner, Physiker, OEko-Institut e. V. Bereich Nukleartechnik Dr. Ulrich Ratsch, Physiker, Forschungsstatte der Evangelischen Studiengemeinschaft Heidelberg
In fast allen Wissenschaftsgebieten nehmen heute elektronische MeB- methoden einen hervorragenden Platz ein. Besonders gilt dies fur die Kern- physik bzw. Kerntechnik, in der oft hOchste Anspruche an die MeBgerate gestellt werden. Urn aber fur eine gestellte meBtechnische Aufgabe die elek- tronischen Anforderungen richtig abzuschatzen bzw. die Moglichkeiten einer vorgegebenen Apparatur zu erkennen, muB der experimentelle Wissen- schaftler bereits uber eine beachtliche Kenntnis der Elektronik verfugen. Auch die Fahigkeit, bei einer MiBfunktion eines elektronischen Gerates den Fehler erkennen, lokalisieren und beheben zu konnen, ist in der Praxis einer effektiven Forschungsarbeit von groBter Wichtigkeit. SchlieBlich erfordert die Kombination verschiedener MeBeinheiten, die oft von verschiedenen Herstellern stammen, ein genaues Verstandnis der Anpassungsbedingungen; die Befahigung, wo notig, einfache Ubergangseinheiten selbst herstellen zu konnen, erspart viel Zeit und Geldmittel. Der zunehmende Einsatz integrierter Bauelemente in den letzten Jahren ermoglicht es einerseits, komplexe elektronische Anlagen in sehr kompakter Bauweise zu konstruieren, kommt aber andererseits auch der elektronischen Betatigung der Wissenschaftler entgegen, deren Ziel nicht die Entwicklung elektronischer Apparaturen ist, sondern fur die diese nur unentbehrliche Hilfsgerate darstellen. Denn bei Verwendung dieser integrierten Elemente erfolgt die Dimensionierung fast zur Ganze durch den Hersteller, der bereits funktionsfahige Baueinheiten zur Verfugung stellt. Es genugt dann, uber die allgemein giiltigen elektronischen Grundlagen Bescheid zu wissen, urn in Verbindung mit den technischen Daten der verwendeten Elemente zu einem Verstandnis der vorliegenden Schaltungen zu kommen.
Dieses Lehrbuch gibt eine Einfuhrung in die Grundlagen der Energie- und Kraftwerkstechnik. Obgleich vertiefend die technisch-naturwissenschaftlichen Aufgaben im Mittelpunkt stehen, werden auch Fragestellungen der Okologie und Okonomie angemessen berucksichtigt. Das Buch liefert den heutigen Stand der Technik und zukunftige Entwicklungsmoglichkeiten, es bringt im Einzelnen: Eine Ubersicht uber die verfugbaren Energiequellen (fossil, regenerativ, nuklear), behandelt die Prinzipien der Umwandlung der jeweiligen Primarenergie in Elektrizitat, die Darstellung moglicher Umweltbelastungen und von Verfahren zu deren Vermeidung, eine Ubersicht uber erreichbare Wirkungsgrade, Anlagenverfugbarkeit und Kosten. Ziel des Buches ist es, den Leser in die Lage zu versetzen, die Moglichkeiten fur die Nutzung der verschiedenen Energiequellen zu beurteilen, den dafur notwendigen Aufwand abzuschatzen und eventuell damit verbundene Risiken zu erkennen. Folglich wendet es sich hauptsachlich an Studenten und in der Praxis tatige Ingenieure der Energie- und Kraftwerkstechnik. Es ist aber auch fur technisch und naturwissenschaftlich vorgebildete Leser gedacht, die sich einen Uberblick uber das Gebiet verschaffen wollen. Fur die 6. Auflage wurde das Buch aktualisiert und erganzt sowie das Kapitel uber CO2-Sequestrierung neu geschrieben. "
Originally perceived as a cheap and plentiful source of power, the
commercial use of nuclear energy has been controversial for
decades. Worries about the dangers that nuclear plants and their
radioactive waste posed to nearby communities grew over time, and
plant construction in the United States virtually died after the
early 1980s. The 1986 disaster at Chernobyl only reinforced nuclear
power's negative image. Yet in the decade prior to the Japanese
nuclear crisis of 2011, sentiment about nuclear power underwent a
marked change. The alarming acceleration of global warming due to
the burning of fossil fuels and concern about dependence on foreign
fuel has led policymakers, climate scientists, and energy experts
to look once again at nuclear power as a source of energy.
With the World desperate to find energy sources that do not emit carbon gasses, nuclear power is back on the agenda and in the news, following the increasing cost of fossil fuels and concerns about the security of their future supply. However, the term 'nuclear power' causes anxiety in many people and there is confusion concerning the nature and extent of the associated risks. Here, Maxwell Irvine presents a concise introduction to the development of nuclear physics leading up to the emergence of the nuclear power industry. He discusses the nature of nuclear energy and deals with various aspects of public concern, considering the risks of nuclear safety, the cost of its development, and waste disposal. Dispelling some of the widespread confusion about nuclear energy, Irvine considers the relevance of nuclear power, the potential of nuclear fusion, and encourages informed debate about its potential. ABOUT THE SERIES: The Very Short Introductions series from Oxford University Press contains hundreds of titles in almost every subject area. These pocket-sized books are the perfect way to get ahead in a new subject quickly. Our expert authors combine facts, analysis, perspective, new ideas, and enthusiasm to make interesting and challenging topics highly readable.
One of the most fundamental problems in elementary particle physics is the study of the interaction of the pion meson with nucleons. It is believed that the pion meson plays a fundamental role in the description of nuclear forces and it is important, therefore, to understand the interaction of these particles. The primary method of gaining information on this interaction is through scattering experiments, and this book is concerned primarily with studies of pion-nucleon scattering at high energies. Originally published in 1969. The Princeton Legacy Library uses the latest print-on-demand technology to again make available previously out-of-print books from the distinguished backlist of Princeton University Press. These editions preserve the original texts of these important books while presenting them in durable paperback and hardcover editions. The goal of the Princeton Legacy Library is to vastly increase access to the rich scholarly heritage found in the thousands of books published by Princeton University Press since its founding in 1905.
Control of nuclear material comprises the administrative and technical measures applied to ensure that nuclear material is not misused or removed from its assigned location without approval and/or without proper accounting. This publication, which builds upon the Implementing Guide IAEA Nuclear Security Series No.25-G , focuses on the control of nuclear material during storage, use and movement using a facility's nuclear material accounting and control (NMAC) system. It describes practical measures for controlling nuclear material for nuclear security purposes during all activities at a facility, including movements, and how to use a graded approach in applying such measures. The technical guidance provided is targeted at States and their competent authorities on how to use individual elements of the NMAC system, but will be also useful for persons responsible for designing, operating and assessing nuclear security systems, physical protection of nuclear facilities, nuclear security management, operators and managers of NMAC systems; as well as for those preparing associated regulations; and persons responsible for computer security at nuclear facilities.
This open access book is a pedagogical text on nuclear reactor experiments, covering almost all the experiments that can be carried out at the University Training Reactor, Kindai University (UTR-KINKI) with respect to reactor physics and radiation detection, and additionally including academic materials of test and research reactors, nuclear instrumentation, nuclear laws and regulations, in this main body. The book is an excellent primer for students who are interested in reactor physics, radiation detection, nuclear laws and regulations at universities, and the best textbook for students who have started to study the nuclear energy related fields to understand the basic theories and principles of the experiments in the fields of reactor physics and radiation detection. UTR-KINKI has been used for educational reactor experiments and basic research in a wide range of fields related to the use of radiation (neutrons, gamma-ray, beta-ray, alpha-ray, and X-ray), including reactor physics, radiation detection, radiation health physics, activation analysis, radiation biology, medical applications and archaeology. Also, UTR-KINKI has been actively engaged in nuclear education with its long history of operation, and has gained extensive experience in educational activities for undergraduate and graduate students, elementary, junior high and high school teachers, junior high and high school students, and general audiences.
Fusion: The Search For Endless Energy is the story of the international race to build an atomic fusion reactor and of the fraternity of scientists whose mission to create safe, clean, inexhaustible energy from the elements of seawater, transcended political boundaries. These scientists included such greats as Andrei Sakharov and Edward Teller. The book abounds with fascinating anecdotes about fusion's rocky path: the spurious claim by Argentine dictator Juan Peron in 1951 that his nation had built a working fusion reactor; the rush by the United States to drop secrecy and publicize its fusion work as a propaganda offensive after the Russian success with Sputnik; the fortune the Penthouse magazine publisher Bob Guccione sank into an unconventional fusion device; the skepticism that met an assertion by two University of Utah chemists in 1989 that they had created "cold fusion" in a bottle. Aimed at a general audience, the book describes the scientific basis of controlled fusion--the fusing of atomic nuclei, under conditions hotter than the sun, to release energy. Using personal recollections of scientists involved, the book traces the history of this little known international race that began during the Cold War in secret laboratories in the U.S., Great Britain, and the Soviet Union, and evolved into an astonishingly open collaboration between East and West.
This book is aimed at scientists and engineers wanting to use radioisotopes and the emitted ionising radiations competently but without seeking expertise. It describes decay and stability criteria, necessary precautions to ensure radiation protection and the detection of alpha, beta and gamma rays including spectrometry. There are comments on calorimetry, liquid scintillation counting, how to use secondary standard instruments, high resolution detectors and how to calculate counting results estimating uncertainties and allowing for the statistics of radionuclide decays. The book's principal purpose is to encourage radionuclide applications which can be done safely, reliably and accurately. It describes industrial and scientific applications of alpha, beta, and gamma rays, neutrons and high energy radiations. This book will be of particular interest to scientists and technologists, teachers and students, helping them to work with radioisotopes safely, efficiently and reliably.
This book provides a comprehensive yet accessible overview of all relevant topics in the field of radiation protection (health physics). The text is organized to introduce the reader to basic principles of radiation emission and propagation, to review current knowledge and historical aspects of the biological effects of radiation, and to cover important operational topics such as radiation shielding and dosimetry. The author 's website contains materials for instructors including PowerPoint slides for lectures and worked-out solutions to end-of-chapter exercises. The book serves as an essential handbook for practicing health physics professionals.
Synthesizing the theoretical and experimental advances in pion-nucleon interactions over approximately the last twelve years, the authors offer here a timely account of the hadronic interactions of pions and nucleons and of the structure of nucleons. Because of the hadronic SU3 symmetry, the book also treats the structure of baryons in general, and so contains much material external to the specific field of pion-nucleon interactions. Thus the book's subject can be stated as the hadronic structure of baryons as illustrated particularly by pion-nucleon interaction. Following an introductory discussion of isotopic spin, the authors proceed to chapters that treat low energy pion scattering by nucleons and the photoproduction of pions; forward and fixed momentum transfer dispersion relations; analytic properties of scattering amplitudes; formation of nucleon resonances; symmetries and classification of particles and resonances; current algebra, sum rules, and superconvergence relations; scattering at higher energies; pion-nucleon dynamics; pion-nucleon inelastic scattering; and the form factors of the nucleon and the pion. Each chapter is followed by abundant references to the original literature. The level of the writing is suitable for students at the graduate level, and the presentation is even and self-contained. On balance, the authors have prepared a useful consolidation and review of this difficult and changing area of investigation. Originally published in 1973. The Princeton Legacy Library uses the latest print-on-demand technology to again make available previously out-of-print books from the distinguished backlist of Princeton University Press. These editions preserve the original texts of these important books while presenting them in durable paperback and hardcover editions. The goal of the Princeton Legacy Library is to vastly increase access to the rich scholarly heritage found in the thousands of books published by Princeton University Press since its founding in 1905.
In Japan's Nuclear Disaster and the Politics of Safety Governance, Florentine Koppenborg argues that the regulatory reforms taken up in the wake of the Fukushima disaster on March 11, 2011, directly and indirectly raised the costs of nuclear power in Japan. The Nuclear Regulation Authority resisted capture by the nuclear industry and fundamentally altered the environment for nuclear policy implementation. Independent safety regulation changed state-business relations in the nuclear power domain from regulatory capture to top-down safety regulation, which raised technical safety costs for electric utilities. Furthermore, the safety agency's extended emergency preparedness regulations expanded the allegorical backyard of NIMBY demonstrations. Antinuclear protests, mainly lawsuits challenging restarts, incurred additional social acceptance costs. Increasing costs undermined pronuclear actors' ability to implement nuclear power policy and caused a rift inside the "nuclear village." Small nuclear safety administration reforms were, in fact, game changers for nuclear power politics in Japan. Koppenborg's findings contribute to the vibrant conversations about the rise of independent regulatory agencies, crisis as a mechanism for change, and the role of nuclear power amid global interest in decarbonizing our energy supply.
This Safety Guide provides recommendations on meeting the requirements of IAEA Safety Standards Series No. SSR-2/1 (Rev. 1) relevant to reactor containment and associated systems. The publication addresses the containment structure and the systems with the functions of isolation, control and management of mass and energy releases, control and limitation of radioactive releases, and control and management of combustible gases. The Safety Guide is intended for use primarily for land based, stationary nuclear power plants with water cooled reactors designed for electricity generation or for other heat generating applications, such as for district heating or desalination.
This publication addresses costs arising during individual phases of an environmental remediation project, how they can be calculated, and how they can be structured and documented. It provides the methodology of cost estimation and includes examples of cost estimate models, development plans, cost elements and work breakdown structures. The guide also contains an overview of potentially suitable remediation technologies, which may help the reader to structure the options study.
This is a paperback edition of Professor Walker's full-scale examination of the German efforts to harness the economic, military and political power of nuclear fission between 1939 and 1949. It argues that the German decision not to attempt the production of nuclear weapons during World War II came as a result of economic and political developments, not scientific or moral considerations, and was at the time a perfectly reasonable policy. Professor Walker also places nuclear fission research in the contexts of the war effort and German cultural imperialism, including the plunder and exploitation of "Greater Germany," the German slave labor economy, and the ambivalent interaction between the Nazi party and the German physicists. The book begins at the height of the Empire, and carries the story through to the founding of the two postwar republics in order to emphasize continuity before and after the Third Reich, and to compare the scientists' activity during the war and after the shock of Hiroshima and the Nuremberg trials. Throughout, Professor Walker explains clearly, in terms that the non-specialist can understand, what was involved in the Germans' quest, and in what ways the German scientists succeeded or failed in the development of "the bomb."
This publication provides detailed guidance with regard to the identification of vital areas at nuclear facilities. It presents a structured approach to identifying those areas that contain equipment, systems and components to be protected against sabotage. The process for selection of a specific set of vital areas to be protected is based on consideration of the potential radiological consequences of sabotage, and on the design, operational and safety features of a nuclear facility. The method builds upon safety analysis to develop logic models for sabotage scenarios that could cause unacceptable radiological consequences. The sabotage actions represented in the logic models are linked to the areas from which they can be accomplished. The logic models are then analysed to determine areas that should be protected to prevent these unacceptable radiological consequences. The publication is part of a set of supporting publications in the IAEA Nuclear Security Series with the aim of assisting States in the design, implementation and evaluation of their physical protection systems for nuclear material and nuclear facilities.
This is a study of atomic nuclei, the properties of which find applications in diverse fields such as medicine and the generation of nuclear power. The explanations of nuclear structure and nuclear reactions in terms of constituent particles led to the discovery of new unstable particles culminating in the unified theory of electromagnetic and weak-nuclear interactions. In this new edition the author has updated the information and included a section on the relevance of recent discoveries to cosmology. Advances in accelerator and detector technology are noted and there is an account of nuclear reactions. Mathematical material is mostly to be found in the appendices. This book may be used as a first student text for courses in nuclear physics.
This publication presents a systematic approach to establishing and operating a national nuclear security support centre (NSSC) as a means to strengthen the sustainability of nuclear security in a State. It provides specific practical guidance to States, detailing a straightforward decision making and project management process drawn from good practices in establishing and operating an NSSC that were identified through the experience and lessons learned from States within the NSSC Network. The publication, which is a revision of TECDOC-1734, is intended for use by the IAEA and the NSSC Network as the primary reference for activities to support States with the establishment and operation of an NSSC.
Wahrend der letzten 20 Jahre hat die Hochenergiephysik dramatische neue Erkenntnisse tiber das elementare Verhalten von Materie gewonnen. Die Entdeckung der Unsymmetrie der Natur unter Spiegelung und Zeitumkehr hat jahrhundertealte Denkgewohnheiten in Frage gestellt. Neue Qualitaten der Materie, die man "Seltsamkeit" und "Charme" nennt, wurden entdeckt. Unter den Namen "Quarkmodell" und "Charme" beginnt sich eine neue Substruktur der Materie abzuzeichnen, wonach die bisherigen elementaren Kernbausteine Proton und Neutron in "Wirklichkeit" als komplexe Gebilde verstanden werden miissen. Eine weitere Umwalzung kiindigt sich bei der schwachen Wechselwir kung an, wo man, gesttitzt auf die Entdeckung der neutralen schwachen Strome, hoffen kann, eine Briicke zwischen elektromagnetischer und schwacher Wechselwirkung zu schlagen. Das Buch mochte in diese Dinge einflihren und den zum Verstandnis notigen Unterbau vermitteln, wobei Grundkenntnisse der Atom- und Kernphysik sowie der Quanten mechanik vorausgesetzt werden. Es ist bestimmt fUr Studierende der Physik und enthalt etwa den Stoff einer Einflihrungsvorlesung in die Hochenergiephysik. Weiterhin ist es gedacht flir Physiker, die sich als Nichtspezialisten einen Einblick in dieses Gebiet ver schaffen mochten. Das erste Kapitel enthiilt einen Oberblick tiber das ganze Gebiet. Die drei folgenden Kapitel vertiefen die im ersten Kapitel behandelten Dinge. Der Charakter einer kurz gehaltenen Einflihrung bringt es mit sich, dall. der Spezialist einige ihm liebe Themen verrnissen wird, wie Regge-Pole, Dispersionsbeziehungen, Dualitat, Statistisches Modell. Dazu findet man in der ausflihrlichen Literatur sehr gute Einflihrungen. Teile der 1. Auflage des Buches entstanden wahrend eines Aufenthalts am Kernfor schungszentrum CERN in Genf, dessen anregender Atmosphare ich viel verdanke."
On the morning of April 26, 1986, a Soviet nuclear plant at Chernobyl (near Kiev) exploded, pouring radioactivity into the environment and setting off the worst disaster in the history of nuclear energy. Now a former Soviet scientist gives a comprehensive account of the catastrophe. |
![]() ![]() You may like...
The Internet of Things for Smart Urban…
Franco Cicirelli, Antonio Guerrieri, …
Hardcover
R4,408
Discovery Miles 44 080
Moral Entanglements - The Ancillary-Care…
Henry S. Richardson
Hardcover
R2,083
Discovery Miles 20 830
Sensing Emotions - The impact of context…
Joyce Westerink, Martijn Krans, …
Hardcover
R2,879
Discovery Miles 28 790
Physics of Biological Membranes
Patricia Bassereau, Pierre Sens
Hardcover
R7,673
Discovery Miles 76 730
|