0
Your cart

Your cart is empty

Browse All Departments
Price
  • R100 - R250 (3)
  • R250 - R500 (42)
  • R500+ (1,065)
  • -
Status
Format
Author / Contributor
Publisher

Books > Professional & Technical > Energy technology & engineering > Nuclear power & engineering

The Economics and Uncertainties of Nuclear Power (Hardcover): Francois Leveque The Economics and Uncertainties of Nuclear Power (Hardcover)
Francois Leveque
R1,679 Discovery Miles 16 790 Ships in 12 - 19 working days

Is nuclear power a thing of the past or a technology for the future? Has it become too expensive and dangerous, or is it still competitive and sufficiently safe? Should emerging countries invest in it? Can we trust calculations of the probability of a major nuclear accident? In the face of divergent claims and contradictory facts, this book provides an in-depth and balanced economic analysis of the main controversies surrounding nuclear power. Without taking sides, it helps readers gain a better understanding of the uncertainties surrounding the costs, hazards, regulation and politics of nuclear power. Written several years on from the Fukushima Daiichi nuclear disaster of 2011, this is an important resource for students, researchers, energy professionals and concerned citizens wanting to engage with the continuing debate on the future of nuclear power and its place in international energy policy.

Energie - Physikalische Grundlagen ihrer Erzeugung, Umwandlung und Nutzung (German, Paperback, 3., vollst. uberarb. u. erw.... Energie - Physikalische Grundlagen ihrer Erzeugung, Umwandlung und Nutzung (German, Paperback, 3., vollst. uberarb. u. erw. Aufl. 2014)
Bernd Diekmann, Eberhard Rosenthal
R1,851 Discovery Miles 18 510 Ships in 10 - 15 working days

In dem vorliegenden Band wird naturwissenschaftlich-physikalische Hintergrundinformation zum Thema Energie bereitgestellt, um dem Leser objektive Bewertungskriterien fur die global hochaktuelle Diskussion der Zukunft unserer Energieversorgung an die Hand zu geben. Insbesondere ist es ein zentrales Anliegen, dem Leser eine Bilanzierung aller Quellen hinsichtlich der Einflussnahme ihrer Gewinnung und Verwendung auf die Umwelt zu erstellen und das jeweilige Risiko zueinander in Relation zu setzen. Nach Festlegung des Begriffes Energie und ihrer Erscheinungsformen werden globale Randbedingungen des Umgangs mit Energie aufgezeigt. Diese Randbedingungen werden sodann fur Deutschland als typischem Industrieland enger eingegrenzt. Die Palette infrage kommender Quellen, fossile, erneuerbare und nukleare, wird sodann im Detail vorgestellt. Ergiebigkeit der Ressourcen sowie sonstige Moglichkeiten und Grenzen des Einsatzes werden diskutiert; alle Energiequellen werden sodann nach Definition eines energetischen Erntefaktors miteinander verglichen. Die Speicher- und Transportmoglichkeiten und - hiermit eng verbunden - die Handlungsspielraume rationellen Umgangs mit den diversen Formen der Energie bilden einen weiteren Schwerpunkt. Der an naturwissenschaftlicher Hintergrundinformation interessierte Leser findet in einem gesonderten Kapitel eine detaillierte Prasentierung ausgewahlter Techniken."

Reaktortechnik - Physikalisch-technische Grundlagen (German, Paperback, 2., beu bearb. Aufl. 2013): Albert Ziegler, Hans-Josef... Reaktortechnik - Physikalisch-technische Grundlagen (German, Paperback, 2., beu bearb. Aufl. 2013)
Albert Ziegler, Hans-Josef Allelein
R2,384 Discovery Miles 23 840 Ships in 10 - 15 working days

Im Buch Reaktortechnik werden die physikalisch-technischen Grundlagen und deren konkrete Umsetzung in Kraftwerken beschrieben. Nach der Darstellung der kernphysikalischen und thermohydraulischen Grundlagen beschreiben die Autoren Grundprinzipien und Aufbau bewahrter Reaktorkonzepte ebenso wie die neuen Entwicklungen. Einen weiteren Schwerpunkt bilden Betrieb, Werkstoff- und Zuverlassigkeitsfragen. Abschliessend gehen die Autoren auf den Brennstoffkreislauf vom Uranabbau bis zur Entsorgung ein.

Motivation der Herausgeber war, den heutigen Stand des Wissens der Reaktortechnik zusammenzutragen und Ingenieuren in Studium und Praxis zuganglich zu machen. Das Buch basiert auf dem von Albert Ziegler herausgegebenen Standardwerk der Reaktortechnik.

Das Buch eignet sich nicht nur als Lehrbuch fur Studierende, sondern auch als Nachschlagewerk fur die berufliche Praxis.

Chernobyl - The Incredible True Story Of The World's Worst Nuclear Disaster (History Of A Human Disaster Life Death... Chernobyl - The Incredible True Story Of The World's Worst Nuclear Disaster (History Of A Human Disaster Life Death Rebirth) (Paperback)
Thomas Housel
R475 R439 Discovery Miles 4 390 Save R36 (8%) Ships in 10 - 15 working days
Die Singulare Waffe - Was bleibt vom Atomzeitalter? (German, Paperback, 2012 ed.): Constanze Eisenbart Die Singulare Waffe - Was bleibt vom Atomzeitalter? (German, Paperback, 2012 ed.)
Constanze Eisenbart
R1,979 Discovery Miles 19 790 Ships in 10 - 15 working days

Seit Hiroshima gilt die Atombombe als singulare Waffe. Ihre Auswirkungen in Raum und Zeit sind analogielos. Ein machtiges Tabu liegt auf ihrer Anwendung. Ihr Besitz war nur funf Staaten erlaubt. Gleichzeitig wurde sie von Anfang an politisch und strategisch instrumentalisiert. Das "Gleichgewicht des Schreckens" wurde zum Signum des Atomzeitalters. Nach 1989 scheint sich dieses Tabu allmahlich aufzuloesen. Die Zahl der Staaten, die uber Nuklearwaffen verfugen, wachst langsam, aber sie wachst. Eine Gruppe von zwoelf Wissenschaftlern - Physikern, Kerntechnikern, Politologen, Historikern und einem Voelkerrechtler - hat die verschiedenen Aspekte der Singularitatsthese diskutiert und legt jetzt die Ergebnisse ihrer Arbeit in zwoelf Aufsatzen vor. Jeder Autor betont andere Aspekte. Der Band enthalt also weder abschliessende noch gar einfache Loesungen. Er zeigt, dass die von Vielen geforderte Abschaffung der Kernwaffen und damit das Ende des Atomzeitalters erst moeglich wird, wenn man die politischen, militarischen, technischen und sozialen Hindernisse klar erkennt, die es zu uberwinden gilt. Seit Hiroshima gilt die Atombombe als singulare Waffe. Ihre Auswirkungen in Raum und Zeit sind analogielos. Ein machtiges Tabu liegt auf ihrer Anwendung. Ihr Besitz war nur funf Staaten erlaubt. Gleichzeitig wurde sie von Anfang an politisch und strategisch instrumentalisiert. Das "Gleichgewicht des Schreckens" wurde zum Signum des Atomzeitalters. Nach 1989 scheint sich dieses Tabu allmahlich aufzuloesen. Die Zahl der Staaten, die uber Nuklearwaffen verfugen, wachst langsam, aber sie wachst. Eine Gruppe von zwoelf Wissenschaftlern - Physikern, Kerntechnikern, Politologen, Historikern und einem Voelkerrechtler - hat die verschiedenen Aspekte der Singularitatsthese diskutiert und legt jetzt die Ergebnisse ihrer Arbeit in zwoelf Aufsatzen vor. Jeder Autor betont andere Aspekte. Der Band enthalt also weder abschliessende noch gar einfache Loesungen. Er zeigt, dass die von Vielen geforderte Abschaffung der Kernwaffen und damit das Ende des Atomzeitalters erst moeglich wird, wenn man die politischen, militarischen, technischen und sozialen Hindernisse klar erkennt, die es zu uberwinden gilt. UEber die Beitragsautoren: Dr. Leopold Barleon, Ing., Kernforschungszentrum Karlsruhe Prof. Dr. Hans-Joachim Bieber, Historiker, Universitat Kassel Dr. Eric Chauvistre, Politikwissenschaftler, FU Berlin/ Redakteur ZDF, Reuters, TAZ Dr. Constanze Eisenbart, Historikerin, Forschungsstatte der Evangelischen Studiengemeinschaft Heidelberg Prof. Dr. Christopher Daase, Politikwissenschaftler, Hessische Stiftung Friedens- und Konfliktforschung, Frankfurt Wilhelm Gmelin, Ing. Luft- und Raumfahrttechniker, ehem. Direktor der EURATOM Prof. Dr. Erwin Hackel, Politikwissenschaftler, Universitat Konstanz Prof. Dr. Martin Kalinowski, Kernphysikerer, Direktor des Carl Friedrich von Weizsacker-Zentrums der Universitat Hamburg Prof. Dr. Egbert Kankeleit, Kernphysiker em., TU Darmstadt Prof. Dr. Thilo Marauhn, Jurist, Universitat Giessen Dr. Christoph Pistner, Physiker, OEko-Institut e. V. Bereich Nukleartechnik Dr. Ulrich Ratsch, Physiker, Forschungsstatte der Evangelischen Studiengemeinschaft Heidelberg

Lehrbuch Der Nuklearelektronik (German, Paperback, Softcover Reprint of the Original 1st 1970 ed.): Peter Weinzierl, Manfred... Lehrbuch Der Nuklearelektronik (German, Paperback, Softcover Reprint of the Original 1st 1970 ed.)
Peter Weinzierl, Manfred Drosg
R1,718 Discovery Miles 17 180 Ships in 10 - 15 working days

In fast allen Wissenschaftsgebieten nehmen heute elektronische MeB- methoden einen hervorragenden Platz ein. Besonders gilt dies fur die Kern- physik bzw. Kerntechnik, in der oft hOchste Anspruche an die MeBgerate gestellt werden. Urn aber fur eine gestellte meBtechnische Aufgabe die elek- tronischen Anforderungen richtig abzuschatzen bzw. die Moglichkeiten einer vorgegebenen Apparatur zu erkennen, muB der experimentelle Wissen- schaftler bereits uber eine beachtliche Kenntnis der Elektronik verfugen. Auch die Fahigkeit, bei einer MiBfunktion eines elektronischen Gerates den Fehler erkennen, lokalisieren und beheben zu konnen, ist in der Praxis einer effektiven Forschungsarbeit von groBter Wichtigkeit. SchlieBlich erfordert die Kombination verschiedener MeBeinheiten, die oft von verschiedenen Herstellern stammen, ein genaues Verstandnis der Anpassungsbedingungen; die Befahigung, wo notig, einfache Ubergangseinheiten selbst herstellen zu konnen, erspart viel Zeit und Geldmittel. Der zunehmende Einsatz integrierter Bauelemente in den letzten Jahren ermoglicht es einerseits, komplexe elektronische Anlagen in sehr kompakter Bauweise zu konstruieren, kommt aber andererseits auch der elektronischen Betatigung der Wissenschaftler entgegen, deren Ziel nicht die Entwicklung elektronischer Apparaturen ist, sondern fur die diese nur unentbehrliche Hilfsgerate darstellen. Denn bei Verwendung dieser integrierten Elemente erfolgt die Dimensionierung fast zur Ganze durch den Hersteller, der bereits funktionsfahige Baueinheiten zur Verfugung stellt. Es genugt dann, uber die allgemein giiltigen elektronischen Grundlagen Bescheid zu wissen, urn in Verbindung mit den technischen Daten der verwendeten Elemente zu einem Verstandnis der vorliegenden Schaltungen zu kommen.

Kraftwerkstechnik - zur Nutzung fossiler, nuklearer und regenerativer Energiequellen (German, Paperback, 6. Aufl. 2010): Karl... Kraftwerkstechnik - zur Nutzung fossiler, nuklearer und regenerativer Energiequellen (German, Paperback, 6. Aufl. 2010)
Karl Strauss
R2,675 Discovery Miles 26 750 Ships in 10 - 15 working days

Dieses Lehrbuch gibt eine Einfuhrung in die Grundlagen der Energie- und Kraftwerkstechnik. Obgleich vertiefend die technisch-naturwissenschaftlichen Aufgaben im Mittelpunkt stehen, werden auch Fragestellungen der Okologie und Okonomie angemessen berucksichtigt.

Das Buch liefert den heutigen Stand der Technik und zukunftige Entwicklungsmoglichkeiten, es bringt im Einzelnen: Eine Ubersicht uber die verfugbaren Energiequellen (fossil, regenerativ, nuklear), behandelt die Prinzipien der Umwandlung der jeweiligen Primarenergie in Elektrizitat, die Darstellung moglicher Umweltbelastungen und von Verfahren zu deren Vermeidung, eine Ubersicht uber erreichbare Wirkungsgrade, Anlagenverfugbarkeit und Kosten.

Ziel des Buches ist es, den Leser in die Lage zu versetzen, die Moglichkeiten fur die Nutzung der verschiedenen Energiequellen zu beurteilen, den dafur notwendigen Aufwand abzuschatzen und eventuell damit verbundene Risiken zu erkennen. Folglich wendet es sich hauptsachlich an Studenten und in der Praxis tatige Ingenieure der Energie- und Kraftwerkstechnik. Es ist aber auch fur technisch und naturwissenschaftlich vorgebildete Leser gedacht, die sich einen Uberblick uber das Gebiet verschaffen wollen.

Fur die 6. Auflage wurde das Buch aktualisiert und erganzt sowie das Kapitel uber CO2-Sequestrierung neu geschrieben.

"

Nuclear Energy - What Everyone Needs to Know (R) (Hardcover): Charles D. Ferguson Nuclear Energy - What Everyone Needs to Know (R) (Hardcover)
Charles D. Ferguson
R1,248 Discovery Miles 12 480 Ships in 12 - 19 working days

Originally perceived as a cheap and plentiful source of power, the commercial use of nuclear energy has been controversial for decades. Worries about the dangers that nuclear plants and their radioactive waste posed to nearby communities grew over time, and plant construction in the United States virtually died after the early 1980s. The 1986 disaster at Chernobyl only reinforced nuclear power's negative image. Yet in the decade prior to the Japanese nuclear crisis of 2011, sentiment about nuclear power underwent a marked change. The alarming acceleration of global warming due to the burning of fossil fuels and concern about dependence on foreign fuel has led policymakers, climate scientists, and energy experts to look once again at nuclear power as a source of energy.
In this accessible overview, Charles D. Ferguson provides an authoritative account of the key facts about nuclear energy. What is the origin of nuclear energy? What countries use commercial nuclear power, and how much electricity do they obtain from it? How can future nuclear power plants be made safer? What can countries do to protect their nuclear facilities from military attacks? How hazardous is radioactive waste? Is nuclear energy a renewable energy source? Featuring a discussion of the recent nuclear crisis in Japan and its ramifications, Ferguson addresses these questions and more in Nuclear Energy: What Everyone Needs to Know(r), a book that is essential for anyone looking to learn more about this important issue.
What Everyone Needs to Know(r) is a registered trademark of Oxford University Press

Establishing a System for Control of Nuclear Material for Nuclear Security Purposes at a Facility during Use, Storage and... Establishing a System for Control of Nuclear Material for Nuclear Security Purposes at a Facility during Use, Storage and Movement (Paperback)
Iaea
R1,062 Discovery Miles 10 620 Ships in 12 - 19 working days

Control of nuclear material comprises the administrative and technical measures applied to ensure that nuclear material is not misused or removed from its assigned location without approval and/or without proper accounting. This publication, which builds upon the Implementing Guide IAEA Nuclear Security Series No.25-G , focuses on the control of nuclear material during storage, use and movement using a facility's nuclear material accounting and control (NMAC) system. It describes practical measures for controlling nuclear material for nuclear security purposes during all activities at a facility, including movements, and how to use a graded approach in applying such measures. The technical guidance provided is targeted at States and their competent authorities on how to use individual elements of the NMAC system, but will be also useful for persons responsible for designing, operating and assessing nuclear security systems, physical protection of nuclear facilities, nuclear security management, operators and managers of NMAC systems; as well as for those preparing associated regulations; and persons responsible for computer security at nuclear facilities.

Pion-Nucleon Scattering. (IP-11), Volume 11 (Hardcover): Robert J Cence Pion-Nucleon Scattering. (IP-11), Volume 11 (Hardcover)
Robert J Cence
R2,644 Discovery Miles 26 440 Ships in 10 - 15 working days

One of the most fundamental problems in elementary particle physics is the study of the interaction of the pion meson with nucleons. It is believed that the pion meson plays a fundamental role in the description of nuclear forces and it is important, therefore, to understand the interaction of these particles. The primary method of gaining information on this interaction is through scattering experiments, and this book is concerned primarily with studies of pion-nucleon scattering at high energies. Originally published in 1969. The Princeton Legacy Library uses the latest print-on-demand technology to again make available previously out-of-print books from the distinguished backlist of Princeton University Press. These editions preserve the original texts of these important books while presenting them in durable paperback and hardcover editions. The goal of the Princeton Legacy Library is to vastly increase access to the rich scholarly heritage found in the thousands of books published by Princeton University Press since its founding in 1905.

Fusion - The Search for Endless Energy (Paperback, New ed): Robin Herman Fusion - The Search for Endless Energy (Paperback, New ed)
Robin Herman
R1,775 Discovery Miles 17 750 Ships in 12 - 19 working days

Fusion: The Search For Endless Energy is the story of the international race to build an atomic fusion reactor and of the fraternity of scientists whose mission to create safe, clean, inexhaustible energy from the elements of seawater, transcended political boundaries. These scientists included such greats as Andrei Sakharov and Edward Teller. The book abounds with fascinating anecdotes about fusion's rocky path: the spurious claim by Argentine dictator Juan Peron in 1951 that his nation had built a working fusion reactor; the rush by the United States to drop secrecy and publicize its fusion work as a propaganda offensive after the Russian success with Sputnik; the fortune the Penthouse magazine publisher Bob Guccione sank into an unconventional fusion device; the skepticism that met an assertion by two University of Utah chemists in 1989 that they had created "cold fusion" in a bottle. Aimed at a general audience, the book describes the scientific basis of controlled fusion--the fusing of atomic nuclei, under conditions hotter than the sun, to release energy. Using personal recollections of scientists involved, the book traces the history of this little known international race that began during the Cold War in secret laboratories in the U.S., Great Britain, and the Soviet Union, and evolved into an astonishingly open collaboration between East and West.

Practical Applications of Radioactivity and Nuclear Radiations (Paperback, Revised): Gerhart Lowenthal, Peter Airey Practical Applications of Radioactivity and Nuclear Radiations (Paperback, Revised)
Gerhart Lowenthal, Peter Airey
R1,652 Discovery Miles 16 520 Ships in 12 - 19 working days

This book is aimed at scientists and engineers wanting to use radioisotopes and the emitted ionising radiations competently but without seeking expertise. It describes decay and stability criteria, necessary precautions to ensure radiation protection and the detection of alpha, beta and gamma rays including spectrometry. There are comments on calorimetry, liquid scintillation counting, how to use secondary standard instruments, high resolution detectors and how to calculate counting results estimating uncertainties and allowing for the statistics of radionuclide decays. The book's principal purpose is to encourage radionuclide applications which can be done safely, reliably and accurately. It describes industrial and scientific applications of alpha, beta, and gamma rays, neutrons and high energy radiations. This book will be of particular interest to scientists and technologists, teachers and students, helping them to work with radioisotopes safely, efficiently and reliably.

Radiation Detection - Concepts, Methods, and Devices (Hardcover): J.Kenneth Shultis, Douglas McGregor Radiation Detection - Concepts, Methods, and Devices (Hardcover)
J.Kenneth Shultis, Douglas McGregor
R4,486 Discovery Miles 44 860 Ships in 12 - 19 working days

Radiation Detection: Concepts, Methods, and Devices provides a modern overview of radiation detection devices and radiation measurement methods. The book topics have been selected on the basis of the authors' many years of experience designing radiation detectors and teaching radiation detection and measurement in a classroom environment. This book is designed to give the reader more than a glimpse at radiation detection devices and a few packaged equations. Rather it seeks to provide an understanding that allows the reader to choose the appropriate detection technology for a particular application, to design detectors, and to competently perform radiation measurements. The authors describe assumptions used to derive frequently encountered equations used in radiation detection and measurement, thereby providing insight when and when not to apply the many approaches used in different aspects of radiation detection. Detailed in many of the chapters are specific aspects of radiation detectors, including comprehensive reviews of the historical development and current state of each topic. Such a review necessarily entails citations to many of the important discoveries, providing a resource to find quickly additional and more detailed information. This book generally has five main themes: Physics and Electrostatics needed to Design Radiation Detectors Properties and Design of Common Radiation Detectors Description and Modeling of the Different Types of Radiation Detectors Radiation Measurements and Subsequent Analysis Introductory Electronics Used for Radiation Detectors Topics covered include atomic and nuclear physics, radiation interactions, sources of radiation, and background radiation. Detector operation is addressed with chapters on radiation counting statistics, radiation source and detector effects, electrostatics for signal generation, solid-state and semiconductor physics, background radiations, and radiation counting and spectroscopy. Detectors for gamma-rays, charged-particles, and neutrons are detailed in chapters on gas-filled, scintillator, semiconductor, thermoluminescence and optically stimulated luminescence, photographic film, and a variety of other detection devices.

Radiation Protection and Dosimetry - An Introduction to Health Physics (Paperback, Softcover reprint of hardcover 1st ed.... Radiation Protection and Dosimetry - An Introduction to Health Physics (Paperback, Softcover reprint of hardcover 1st ed. 2008)
Michael G. Stabin
R2,440 Discovery Miles 24 400 Ships in 10 - 15 working days

This book provides a comprehensive yet accessible overview of all relevant topics in the field of radiation protection (health physics). The text is organized to introduce the reader to basic principles of radiation emission and propagation, to review current knowledge and historical aspects of the biological effects of radiation, and to cover important operational topics such as radiation shielding and dosimetry. The author 's website contains materials for instructors including PowerPoint slides for lectures and worked-out solutions to end-of-chapter exercises. The book serves as an essential handbook for practicing health physics professionals.

The Pion-Nucleon System (Paperback): B.H. Bransden, R.G. Moorhouse The Pion-Nucleon System (Paperback)
B.H. Bransden, R.G. Moorhouse
R1,982 Discovery Miles 19 820 Ships in 12 - 19 working days

Synthesizing the theoretical and experimental advances in pion-nucleon interactions over approximately the last twelve years, the authors offer here a timely account of the hadronic interactions of pions and nucleons and of the structure of nucleons. Because of the hadronic SU3 symmetry, the book also treats the structure of baryons in general, and so contains much material external to the specific field of pion-nucleon interactions. Thus the book's subject can be stated as the hadronic structure of baryons as illustrated particularly by pion-nucleon interaction. Following an introductory discussion of isotopic spin, the authors proceed to chapters that treat low energy pion scattering by nucleons and the photoproduction of pions; forward and fixed momentum transfer dispersion relations; analytic properties of scattering amplitudes; formation of nucleon resonances; symmetries and classification of particles and resonances; current algebra, sum rules, and superconvergence relations; scattering at higher energies; pion-nucleon dynamics; pion-nucleon inelastic scattering; and the form factors of the nucleon and the pion. Each chapter is followed by abundant references to the original literature. The level of the writing is suitable for students at the graduate level, and the presentation is even and self-contained. On balance, the authors have prepared a useful consolidation and review of this difficult and changing area of investigation. Originally published in 1973. The Princeton Legacy Library uses the latest print-on-demand technology to again make available previously out-of-print books from the distinguished backlist of Princeton University Press. These editions preserve the original texts of these important books while presenting them in durable paperback and hardcover editions. The goal of the Princeton Legacy Library is to vastly increase access to the rich scholarly heritage found in the thousands of books published by Princeton University Press since its founding in 1905.

Labyrinth of the Wind - A Novel of Love and Nuclear Secrets in Tehran (Paperback): Madhav Misra Labyrinth of the Wind - A Novel of Love and Nuclear Secrets in Tehran (Paperback)
Madhav Misra
R450 Discovery Miles 4 500 Ships in 10 - 15 working days
Japan's Nuclear Disaster and the Politics of Safety Governance (Hardcover): Florentine Koppenborg Japan's Nuclear Disaster and the Politics of Safety Governance (Hardcover)
Florentine Koppenborg
R1,128 Discovery Miles 11 280 Ships in 12 - 19 working days

In Japan's Nuclear Disaster and the Politics of Safety Governance, Florentine Koppenborg argues that the regulatory reforms taken up in the wake of the Fukushima disaster on March 11, 2011, directly and indirectly raised the costs of nuclear power in Japan. The Nuclear Regulation Authority resisted capture by the nuclear industry and fundamentally altered the environment for nuclear policy implementation. Independent safety regulation changed state-business relations in the nuclear power domain from regulatory capture to top-down safety regulation, which raised technical safety costs for electric utilities. Furthermore, the safety agency's extended emergency preparedness regulations expanded the allegorical backyard of NIMBY demonstrations. Antinuclear protests, mainly lawsuits challenging restarts, incurred additional social acceptance costs. Increasing costs undermined pronuclear actors' ability to implement nuclear power policy and caused a rift inside the "nuclear village." Small nuclear safety administration reforms were, in fact, game changers for nuclear power politics in Japan. Koppenborg's findings contribute to the vibrant conversations about the rise of independent regulatory agencies, crisis as a mechanism for change, and the role of nuclear power amid global interest in decarbonizing our energy supply.

Design of the Reactor Containment and Associated Systems for Nuclear Power Plants (Paperback): Iaea Design of the Reactor Containment and Associated Systems for Nuclear Power Plants (Paperback)
Iaea
R1,370 Discovery Miles 13 700 Ships in 9 - 17 working days

This Safety Guide provides recommendations on meeting the requirements of IAEA Safety Standards Series No. SSR-2/1 (Rev. 1) relevant to reactor containment and associated systems. The publication addresses the containment structure and the systems with the functions of isolation, control and management of mass and energy releases, control and limitation of radioactive releases, and control and management of combustible gases. The Safety Guide is intended for use primarily for land based, stationary nuclear power plants with water cooled reactors designed for electricity generation or for other heat generating applications, such as for district heating or desalination.

German National Socialism and the Quest for Nuclear Power, 1939-49 (Paperback, New Ed): Mark Walker German National Socialism and the Quest for Nuclear Power, 1939-49 (Paperback, New Ed)
Mark Walker
R1,318 Discovery Miles 13 180 Ships in 12 - 19 working days

This is a paperback edition of Professor Walker's full-scale examination of the German efforts to harness the economic, military and political power of nuclear fission between 1939 and 1949. It argues that the German decision not to attempt the production of nuclear weapons during World War II came as a result of economic and political developments, not scientific or moral considerations, and was at the time a perfectly reasonable policy. Professor Walker also places nuclear fission research in the contexts of the war effort and German cultural imperialism, including the plunder and exploitation of "Greater Germany," the German slave labor economy, and the ambivalent interaction between the Nazi party and the German physicists.

The book begins at the height of the Empire, and carries the story through to the founding of the two postwar republics in order to emphasize continuity before and after the Third Reich, and to compare the scientists' activity during the war and after the shock of Hiroshima and the Nuremberg trials. Throughout, Professor Walker explains clearly, in terms that the non-specialist can understand, what was involved in the Germans' quest, and in what ways the German scientists succeeded or failed in the development of "the bomb."

Identification of vital areas at nuclear facilities (Paperback): International Atomic Energy Agency Identification of vital areas at nuclear facilities (Paperback)
International Atomic Energy Agency
R653 Discovery Miles 6 530 Ships in 12 - 19 working days

This publication provides detailed guidance with regard to the identification of vital areas at nuclear facilities. It presents a structured approach to identifying those areas that contain equipment, systems and components to be protected against sabotage. The process for selection of a specific set of vital areas to be protected is based on consideration of the potential radiological consequences of sabotage, and on the design, operational and safety features of a nuclear facility. The method builds upon safety analysis to develop logic models for sabotage scenarios that could cause unacceptable radiological consequences. The sabotage actions represented in the logic models are linked to the areas from which they can be accomplished. The logic models are then analysed to determine areas that should be protected to prevent these unacceptable radiological consequences. The publication is part of a set of supporting publications in the IAEA Nuclear Security Series with the aim of assisting States in the design, implementation and evaluation of their physical protection systems for nuclear material and nuclear facilities.

Developing Cost Estimates for Environmental Remediation Projects (Paperback): Iaea Developing Cost Estimates for Environmental Remediation Projects (Paperback)
Iaea
R1,328 Discovery Miles 13 280 Ships in 9 - 17 working days

This publication addresses costs arising during individual phases of an environmental remediation project, how they can be calculated, and how they can be structured and documented. It provides the methodology of cost estimation and includes examples of cost estimate models, development plans, cost elements and work breakdown structures. The guide also contains an overview of potentially suitable remediation technologies, which may help the reader to structure the options study.

Establishing and Operating a National Nuclear Security Support Centre (French Edition) (Paperback): Iaea Establishing and Operating a National Nuclear Security Support Centre (French Edition) (Paperback)
Iaea
R547 Discovery Miles 5 470 Ships in 12 - 19 working days

This publication presents a systematic approach to establishing and operating a national nuclear security support centre (NSSC) as a means to strengthen the sustainability of nuclear security in a State. It provides specific practical guidance to States, detailing a straightforward decision making and project management process drawn from good practices in establishing and operating an NSSC that were identified through the experience and lessons learned from States within the NSSC Network. The publication, which is a revision of TECDOC-1734, is intended for use by the IAEA and the NSSC Network as the primary reference for activities to support States with the establishment and operation of an NSSC.

Atomic Nuclei and their Particles (Paperback, 2nd Revised edition): E.J. Burge Atomic Nuclei and their Particles (Paperback, 2nd Revised edition)
E.J. Burge
R1,200 Discovery Miles 12 000 Ships in 12 - 19 working days

This is a study of atomic nuclei, the properties of which find applications in diverse fields such as medicine and the generation of nuclear power. The explanations of nuclear structure and nuclear reactions in terms of constituent particles led to the discovery of new unstable particles culminating in the unified theory of electromagnetic and weak-nuclear interactions. In this new edition the author has updated the information and included a section on the relevance of recent discoveries to cosmology. Advances in accelerator and detector technology are noted and there is an account of nuclear reactions. Mathematical material is mostly to be found in the appendices. This book may be used as a first student text for courses in nuclear physics.

Hochenergiephysik (German, Paperback, 3rd 3.Aufl. 1986 ed.): Erich Lohrmann Hochenergiephysik (German, Paperback, 3rd 3.Aufl. 1986 ed.)
Erich Lohrmann
R1,859 Discovery Miles 18 590 Ships in 10 - 15 working days

Wahrend der letzten 20 Jahre hat die Hochenergiephysik dramatische neue Erkenntnisse tiber das elementare Verhalten von Materie gewonnen. Die Entdeckung der Unsymmetrie der Natur unter Spiegelung und Zeitumkehr hat jahrhundertealte Denkgewohnheiten in Frage gestellt. Neue Qualitaten der Materie, die man "Seltsamkeit" und "Charme" nennt, wurden entdeckt. Unter den Namen "Quarkmodell" und "Charme" beginnt sich eine neue Substruktur der Materie abzuzeichnen, wonach die bisherigen elementaren Kernbausteine Proton und Neutron in "Wirklichkeit" als komplexe Gebilde verstanden werden miissen. Eine weitere Umwalzung kiindigt sich bei der schwachen Wechselwir kung an, wo man, gesttitzt auf die Entdeckung der neutralen schwachen Strome, hoffen kann, eine Briicke zwischen elektromagnetischer und schwacher Wechselwirkung zu schlagen. Das Buch mochte in diese Dinge einflihren und den zum Verstandnis notigen Unterbau vermitteln, wobei Grundkenntnisse der Atom- und Kernphysik sowie der Quanten mechanik vorausgesetzt werden. Es ist bestimmt fUr Studierende der Physik und enthalt etwa den Stoff einer Einflihrungsvorlesung in die Hochenergiephysik. Weiterhin ist es gedacht flir Physiker, die sich als Nichtspezialisten einen Einblick in dieses Gebiet ver schaffen mochten. Das erste Kapitel enthiilt einen Oberblick tiber das ganze Gebiet. Die drei folgenden Kapitel vertiefen die im ersten Kapitel behandelten Dinge. Der Charakter einer kurz gehaltenen Einflihrung bringt es mit sich, dall. der Spezialist einige ihm liebe Themen verrnissen wird, wie Regge-Pole, Dispersionsbeziehungen, Dualitat, Statistisches Modell. Dazu findet man in der ausflihrlichen Literatur sehr gute Einflihrungen. Teile der 1. Auflage des Buches entstanden wahrend eines Aufenthalts am Kernfor schungszentrum CERN in Genf, dessen anregender Atmosphare ich viel verdanke."

The Legacy of Chernobyl (Paperback): Zhores A. Medvedev The Legacy of Chernobyl (Paperback)
Zhores A. Medvedev
R684 Discovery Miles 6 840 Ships in 12 - 19 working days

On the morning of April 26, 1986, a Soviet nuclear plant at Chernobyl (near Kiev) exploded, pouring radioactivity into the environment and setting off the worst disaster in the history of nuclear energy. Now a former Soviet scientist gives a comprehensive account of the catastrophe.

Free Delivery
Pinterest Twitter Facebook Google+
You may like...
Neural-Symbolic Cognitive Reasoning
Artur S. d'Avila Garcez, Luis C. Lamb, … Hardcover R2,389 Discovery Miles 23 890
Neural Computing - An Introduction
R. Beale Paperback R1,970 Discovery Miles 19 700
Intelligent Systems for Optical Networks…
Yousef S. Kavian, Z. Ghassemlooy Hardcover R5,345 Discovery Miles 53 450
Advances in Imaging and Electron…
Peter W. Hawkes Hardcover R5,561 Discovery Miles 55 610
Handbook of Terahertz Technology for…
D. Saeedkia Hardcover R5,142 Discovery Miles 51 420
Introduction to Fiber Optics
John Crisp Paperback R1,007 Discovery Miles 10 070
Atomic and Molecular Manipulation…
Andrew J. Mayne, Gerard Dujardin Hardcover R3,644 Discovery Miles 36 440
Inside Out - Letters to My Children
Robert Powell Hardcover R694 Discovery Miles 6 940
Messy Truth - How to Foster Community…
Caleb Kaltenbach Paperback R414 R385 Discovery Miles 3 850
Self-Compassion for Educators - Mindful…
Lisa Baylis Paperback R513 R484 Discovery Miles 4 840

 

Partners